SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000015884 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000015884
Domain Number 1 Region: 18-187
Classification Level Classification E-value
Superfamily RUN domain-like 1.83e-40
Family RUN domain 0.00077
Further Details:      
 
Domain Number 2 Region: 533-646
Classification Level Classification E-value
Superfamily PH domain-like 1.67e-18
Family Pleckstrin-homology domain (PH domain) 0.0085
Further Details:      
 
Domain Number 3 Region: 684-790
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000149
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000015884
Domain Number - Region: 999-1056
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0389
Family PHD domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000015884   Gene: ENSLAFG00000020707   Transcript: ENSLAFT00000020655
Sequence length 1062
Comment pep:novel supercontig:loxAfr3:scaffold_31:26475079:26511683:-1 gene:ENSLAFG00000020707 transcript:ENSLAFT00000020655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSVVENGLDPRAAIPVIKKKLVGSVKALQKQYVSSDTVVTSEDGDANTMCSALEAVFIH
GLHAKHIRAEAGGKRKKSAHQKPLPQPVFWPLLKAVTHKHIISELEDLVFVNTDVGRCRA
WLRLALNDGLMECYLKLLLQDQARLCEYYQPTALLRDAEEGEFLLSFLQGLTSLSFELSY
KSAILNEWTLTPLALSGLCPLSELDPLTTSGTELQRKESLDSISHSSGSEDIEVQHSGHK
IRRNRKLTASSLSLDTASSSQLSCSLNSDSCLLQENGSKSPDRSEEPMSCDSDLGTANAD
GSDRSLQEVLSEFSKAQVNSVPTNGLSRETEASALQASLSFHGLDTSTHLHLDVLAEPLP
AQASSRTPDGDHKQEPLSQKPGILDLPQLSTAQTTPSGDTSAQKPSGPVREKTRAVRQGS
GPEKTLAGDRVGLNLVVSSPTSPKSKSWISEDDFYRPPQEPPPESPSDHSIASSKGTPGS
RPGLHRHFSLGPRKSHSMGDLDRVPSPGSRKTKAAPEQEHKNFRVVHRRQMGLSNPFRGL
LKLGTLERRGAMGIWKELFCELSPLEFRLYLSDKERTCVENCSLLRCESVGPAHSDGRFE
LVFSGKKLTLRASSQDEAEDWLDRVQEALHKYRPQQEDEWVNIQYPEQPEDLPEAPQGGL
PSHSNALSEPESFQGTQFDWSSAHVPEPDAIKESLLYLYSDRVWAPYIFSLSLESLKCFR
VRNNEKILSDSHGVETIRDILPDTSLGGPSCFKIITAKAVLKLQARNAEEAALWRDLVRK
VLASYLETAEEAVTLGGSLDENCQEVLKFATRENGFLLQYLVAIPTEKGLDSQGCFCAGC
SRQIGFSFVRPKLCAFSGLYYCDICHQDDASVIPARIIHNWDLTKRPICRQALKFLTQIW
AQPLINLQLVNASLYEHVEQMQLIGRSREQLKLLGDYLGLCRSGALKELSKRLNYRNYLL
EFPHKYSIADLQQIAEGVYEGFLKTLIEFASQHVYNCDLCTQRGFICQICHHHDIIFPFE
FDTTVRCAECKTVFHQSCQAVVKKGCPRCARRRKYQEQSILT
Download sequence
Identical sequences G3TLQ5
ENSLAFP00000015884 XP_003414347.1.64505 ENSLAFP00000015884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]