SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000015990 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000015990
Domain Number 1 Region: 126-238
Classification Level Classification E-value
Superfamily C-type lectin-like 1.1e-29
Family C-type lectin domain 0.00000985
Further Details:      
 
Domain Number 2 Region: 99-122
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.00000981
Family Triple coiled coil domain of C-type lectins 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000015990   Gene: ENSLAFG00000020683   Transcript: ENSLAFT00000020669
Sequence length 239
Comment pep:novel supercontig:loxAfr3:scaffold_10:34218810:34222223:1 gene:ENSLAFG00000020683 transcript:ENSLAFT00000020669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLFSSLPLLLLSVMTASCSETCEEVQKTCHVVACGSPGINGLPGTKGEKGEPGQGLRGL
QGPPGKLGPQGPPGLPGLQGVMGPKGDPGKNSDYDSGLAASERQALRSELDRIKQWLIFS
LGKKVGKKVFLTNGEKTTFGRVKALCAQYQGSVATPMNAEENAAIQNVAKGETFVGITDE
ATEGQFVDLTGRSVTFVNWNNGEPNDADNSEDCVMLLKDGKWNDISCSQSFVAVCEFPA
Download sequence
Identical sequences G5E728
ENSLAFP00000015990 ENSLAFP00000015990 XP_003409074.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]