SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000016246 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000016246
Domain Number 1 Region: 69-135
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 7.21e-16
Family Ovomucoid domain III-like 0.0055
Further Details:      
 
Domain Number 2 Region: 164-228
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000277
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 3 Region: 260-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000943
Family EGF-type module 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000016246   Gene: ENSLAFG00000022458   Transcript: ENSLAFT00000022958
Sequence length 374
Comment pep:novel supercontig:loxAfr3:scaffold_3:34888244:35173013:1 gene:ENSLAFG00000022458 transcript:ENSLAFT00000022958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLWESPRQCSSWTLCEGFCWLLLLPVMLLIVVRPVKLAAFPTSLSDCQTPTGWNCSGYD
DRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNSDYVPVCGSNGESYQNECYLRQAA
CKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWC
VCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDG
HYARTDFAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHC
EKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAVICVVVLCITRKCPRSNRIHRQKQNTGH
YSSDNTTRASTRLI
Download sequence
Identical sequences G3TMB4
ENSLAFP00000016246 ENSLAFP00000016246 XP_003406209.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]