SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000016574 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000016574
Domain Number 1 Region: 80-212
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-42
Family C-type lectin domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000016574   Gene: ENSLAFG00000022194   Transcript: ENSLAFT00000022447
Sequence length 216
Comment pep:novel supercontig:loxAfr3:scaffold_15:52569860:52575411:1 gene:ENSLAFG00000022194 transcript:ENSLAFT00000022447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEERQEKQRGGQRKIGFVWTAAGVSILLLSACFVTRCVVTYRFFLLCDEENFQPHENITE
LYDYNDGSGTFTETSLLLGSVKNCPLNWKHFQSSCYFFSTNAMTWTSSSKNCSAMGAHLV
VINTEEEQEFLFHTKPRRREFYIGLTDQVAEGQWQWVDGTPFKESLSFWDTGEPNNLATV
EDCATIRDSSNPRKNWNDVPCFFSLFRVCEMPERNI
Download sequence
Identical sequences G3TN20
ENSLAFP00000016574 ENSLAFP00000016574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]