SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000016673 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000016673
Domain Number 1 Region: 290-376,688-763
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000168
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 2 Region: 89-133
Classification Level Classification E-value
Superfamily Elafin-like 0.000000017
Family Elafin-like 0.0019
Further Details:      
 
Domain Number 3 Region: 479-543,890-922
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000863
Family Growth factor receptor domain 0.0094
Further Details:      
 
Domain Number 4 Region: 366-450
Classification Level Classification E-value
Superfamily SEA domain 0.00000127
Family SEA domain 0.01
Further Details:      
 
Domain Number 5 Region: 239-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000189
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000016673   Gene: ENSLAFG00000007706   Transcript: ENSLAFT00000022844
Sequence length 1278
Comment pep:novel supercontig:loxAfr3:scaffold_67:8551806:8635500:1 gene:ENSLAFG00000007706 transcript:ENSLAFT00000022844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKGLSLLSYQLCNYQVTQNVQKVVSFQASSSTNTSCGGWIPWQWCSKTIYRTQYLAVEVP
ETRNVTDCCQGYEQLGLYCVLPLNRSGEFASRPGICPAAGAGPSTSPCTLDTDCPGLQKC
CRWSGGHRCMDPVPPALEKNPANFWYNVTLLVKMDFMELNHVDPQLLNHMRLLHSMVTSV
LQPLGSTVHHLHSASGEPLTTVSQLLLGLPRQLPVVNVSAVLGDITRRVYEVINIQVQVD
VNECLYDELNTCSGRERCLNTEGSYQCVCPQELLTSSPLKPNRTCEDCPPIRNYMVFNVT
SSSFQVSWSLNSTQSHMFHVQVFEGEELVRSARTRGTTLEVVGLEAGVLYGVKTSYRECG
ADVTATLTVRTDARVFEVTIRITNRNFTEQLLNHSSVEYQDFSRQLLQEVGKSFPPAVSD
LYRHGKLRVEIVSLQAGSVVVKLRLTVQDPELPVYISTLTPTLPPLFTSAVFQVDQQGTQ
VQDWDECADSWENDCSAAAQCLNLEGSYTCQCRTARDLNPSRAGRACEGGCPEPQGPGGE
ASTDSTTVAAGRSTLGTPALSHSPANPWNSTAVDQAWSPGPPPRGGEDSSTAGQDRNSTG
GPRPTHGFLLGATDAPLNPTGQLLQNSSVESNSWLAPTTGPTGHIAWYPSPPTQDMLSTS
LSTTWPWSLHPGPSISSDLPSTPRSALQMIPAAFPVPVPIKSIVVSNVTGTSFHVAWEAD
LTMCPTFQLTLTSRQNLTLDVETQNTSVTLSGLEPGILYVVAIADKACGKENAKAHLKVR
TAAQKLSGKVRIANITYSECFRNASSVEYQDFLELFFRVVRNALPAPTLQLMEEGGIKME
VTGVSNGSVVVAFDLLIIADMDAREVLNTFLTALQNVSLLKVVQGDTFIQDYDECERGED
DCVPGTSCLNTLGSFTCSCTGGAPDFWVEYPGRPCKGDSPGNTIQAPGSSLTPGPEQPST
SPESRAPLVQGASPTAQSLSQRMNLTGAVRVLCEIERVAIAIQKHFLQQESIPESSLYLG
KPACNVSSSNSTHVLLVAGWSECGTTVQSNMTNTVVRTTLRNDLSPEGVIHYLKILSPIH
CAFRNDLLTSSGYTPQWGVYTIIEDLQIVGYLVSSVSQGVLVCREMELMSLLSSLCSCPI
PNTYTSVIENGDSNKAQFKLKIFSFINNSIVYLHCRLRICMESPEATCKINCNNFRSLKS
SETPATHLTSWGPLVRSEGDSAGGRPGLGMGYVVLIVVAVFALVTGIAALLILRYQRMTG
RYNFKIQSDNFSYQVFYE
Download sequence
Identical sequences G3TN88
ENSLAFP00000016673 ENSLAFP00000016673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]