SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000016829 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000016829
Domain Number 1 Region: 65-98
Classification Level Classification E-value
Superfamily GLA-domain 0.00000000253
Family GLA-domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000016829   Gene: ENSLAFG00000021787   Transcript: ENSLAFT00000023068
Sequence length 102
Comment pep:novel supercontig:loxAfr3:scaffold_2:4474059:4477451:-1 gene:ENSLAFG00000021787 transcript:ENSLAFT00000023068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLLLLTILAAFTVAILCYESYESLESHELSPFLNRRYANSFISPQERWRAKAQERVRE
LRKPAHELNREACEDFGICERYAMLYGYNAAYNRFFRQRRGT
Download sequence
Identical sequences G5E7B3
ENSLAFP00000016829 ENSLAFP00000016829 XP_003405718.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]