SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000016887 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000016887
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.71e-18
Family Protein kinases, catalytic subunit 0.0000224
Further Details:      
 
Domain Number 2 Region: 103-175
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.25e-18
Family SAM (sterile alpha motif) domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000016887   Gene: ENSLAFG00000023132   Transcript: ENSLAFT00000021859
Sequence length 178
Comment pep:novel supercontig:loxAfr3:scaffold_1555:5413:6353:-1 gene:ENSLAFG00000023132 transcript:ENSLAFT00000021859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWSFGIVMWEVMSYGERPYWDMSDQEVLNAVEQEFRLPPPPGCPPGLHLLMLDTWQKDRA
QRPHFDQLVAALDKMIRKPDTLQAGGGPRDRPSQALLDPVALDFLSLDSPHAWLSAIGLE
CYQDNFARLGLCSFSDVAQLSLEDLPALGVTLAGHQKKLLHNVQLLQQHLRPPGAVEV
Download sequence
Identical sequences G3TNN3
ENSLAFP00000016887 ENSLAFP00000016887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]