SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000016917 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000016917
Domain Number 1 Region: 115-296
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-53
Family SPRY domain 0.00000732
Further Details:      
 
Domain Number 2 Region: 24-83
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000151
Family RING finger domain, C3HC4 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000016917   Gene: ENSLAFG00000021578   Transcript: ENSLAFT00000021625
Sequence length 296
Comment pep:novel supercontig:loxAfr3:scaffold_0:50144379:50145399:-1 gene:ENSLAFG00000021578 transcript:ENSLAFT00000021625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLTTITSERASIALSTLTHFSFFVLTTMAKSLKAEATCPVCLDFFSKPFSLSCAHTFCCD
CLKTWARERKEPILICPMCRKMHERSLLEEWQMTALTFLIKQHGPLLEQRLHLSDRLLRS
REDMTLDAATANSLLVLSSDLRSVQCGKICNNPMEDPNRFTYVTCVLGTPCFSSGRHYWE
VEVGEGKEWSLGVCKESVDRKVKSSLSTEHGFWIISMKAGAIYSSSFPQIRISVSPSLHH
VGIFLDIEMEEVKFFDVRSDTLIYTHDQLSHSEPLRPFFCLELPGEGDSGAPLRIC
Download sequence
Identical sequences G3TNQ5
ENSLAFP00000016917 ENSLAFP00000016917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]