SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000017068 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000017068
Domain Number 1 Region: 29-85
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000018
Family Ovomucoid domain III-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000017068   Gene: ENSLAFG00000022995   Transcript: ENSLAFT00000021361
Sequence length 85
Comment pep:novel supercontig:loxAfr3:scaffold_1:67479873:67483268:1 gene:ENSLAFG00000022995 transcript:ENSLAFT00000021361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIIGGVLLLCTVAHFCNSAETGTPSTRTVDCSIYKKYPVVAIPCPITYLPVCGSDYITY
GNECHLCTESLKSNGKIQFLHEGNC
Download sequence
Identical sequences G3TP12
ENSLAFP00000017068 ENSLAFP00000017068 XP_003404885.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]