SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000017143 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000017143
Domain Number 1 Region: 657-808
Classification Level Classification E-value
Superfamily C-type lectin-like 9.27e-43
Family C-type lectin domain 0.00000573
Further Details:      
 
Domain Number 2 Region: 148-262
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-42
Family Link domain 0.0049
Further Details:      
 
Domain Number 3 Region: 264-357
Classification Level Classification E-value
Superfamily C-type lectin-like 2.65e-30
Family Link domain 0.0069
Further Details:      
 
Domain Number 4 Region: 42-152
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000289
Family V set domains (antibody variable domain-like) 0.065
Further Details:      
 
Domain Number 5 Region: 808-867
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000903
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000017143   Gene: ENSLAFG00000022076   Transcript: ENSLAFT00000022868
Sequence length 906
Comment pep:novel supercontig:loxAfr3:scaffold_33:5099945:5112750:1 gene:ENSLAFG00000022076 transcript:ENSLAFT00000022868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLLLPLLAALAQVPVALADTLLGLPTEDRAFRVRIAGDAPLHGVLGGALTIPCHVHYL
RPPSRRAGLGSPRVKWTFLSRGGEAEVLVARGLRIKVSEAYRFRVALPAYPASLTDVSLA
LSELRPNDSGIYRCEVQHGIDDSSDAVEVKVKGVVFLYREGSARYAFSFAGAQEACARIG
ARIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQTPREACYGDMDGFPGVRNYGVVDPD
DLYDVYCYAEDLNGELFLGAPPEKLTLEEARAYCRERGAKIATTGQLYAAWDGGLDRCSP
GWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFRDSAQPSAIP
ETSNPASDGLEAIVTVTETLEELQLPREAVESESRGAIYSIPIMEDAGGGTSTPEDPAEA
PRTLLEFETQSIIPPTGSSEEEGKLLEEEQKYKDEEEKEEGEEEEADVEDEALWAWPSEL
GSLDPEAPFPTEPALEESLSQASPTARVVLLPGASPHPGRESEAPRPPSVRGPPTETLST
PREEKLASPPPSIPFGVREMGEETGGPELSGVSRGESEETGSSEDALSLLPATRVPEGTR
ELEAPSEENSGRTAPAGSSVRAQPVLPTDSTSHGGVAVVPSSGDCVPSPCHNGGTCLEEE
EGVRCLCLPGYGGDLCDVGLQLCSPGWDAFQGACYKHFSTRRSWEEAETQCRMYGAHLAS
VSTPEEQDFINNRYREYQWIGLNDRTIEGDFLWSDGVPLLYENWNPGQPDSYFLSGENCV
VMVWHDQGQWSDVPCNYHLSYTCKMGLVSCGPPPELPLAQVFGRPRLRYEVDTVLRYQCQ
EGLAQRNLPLIRCQENGHWEPPQISCVPRRPAQALHPAKAPGGHQERLPGRWKALLTPPS
SPTSGP
Download sequence
Identical sequences G3UEA3
ENSLAFP00000017143 ENSLAFP00000026161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]