SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000017273 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000017273
Domain Number 1 Region: 2-132
Classification Level Classification E-value
Superfamily C-type lectin-like 7e-33
Family C-type lectin domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000017273   Gene: ENSLAFG00000022886   Transcript: ENSLAFT00000021461
Sequence length 135
Comment pep:novel supercontig:loxAfr3:scaffold_15:52931714:52933991:-1 gene:ENSLAFG00000022886 transcript:ENSLAFT00000021461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVWGCCPENWMVSNTSCYFITSEENNWTESEKKCTGMGAHLLVINIKEEQLFITQKLNRK
SSYYMGLSEPKWIDQWQWVDQSPYKKNVTFWHPGESNNHKQHCVFISFLNGKWGWNAASC
DMPQKSICEMMKIYL
Download sequence
Identical sequences G3TPG3
ENSLAFP00000017273 ENSLAFP00000017273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]