SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000017732 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000017732
Domain Number 1 Region: 103-167
Classification Level Classification E-value
Superfamily C-type lectin-like 8.22e-18
Family C-type lectin domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000017732   Gene: ENSLAFG00000022715   Transcript: ENSLAFT00000021610
Sequence length 167
Comment pep:novel supercontig:loxAfr3:scaffold_1586:3714:6370:-1 gene:ENSLAFG00000022715 transcript:ENSLAFT00000021610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNQTVTYSRLNLQEPQKQQIKRKDADSSISITEQEITYVELNLHASQDLQKKDKSFHCK
VCLPFPPGKLIAGILGIICTDLMASVITVAVIVVTPSIGMLETLKNIAINFHIQRSSSHC
GRCPEDWLSYSNNCYYVSSDKKTWTESQMACASKKSNLTNIDNEEEM
Download sequence
Identical sequences G3TQC2
ENSLAFP00000017732 ENSLAFP00000017732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]