SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000017759 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000017759
Domain Number 1 Region: 215-356
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-42
Family Third domain of FERM 0.000000431
Further Details:      
 
Domain Number 2 Region: 107-214
Classification Level Classification E-value
Superfamily Second domain of FERM 1.07e-37
Family Second domain of FERM 0.000000679
Further Details:      
 
Domain Number 3 Region: 19-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.48e-25
Family First domain of FERM 0.00000532
Further Details:      
 
Domain Number 4 Region: 503-596
Classification Level Classification E-value
Superfamily Moesin tail domain 2.88e-25
Family Moesin tail domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000017759
Domain Number - Region: 343-473
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0759
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000017759   Gene: ENSLAFG00000023166   Transcript: ENSLAFT00000021700
Sequence length 596
Comment pep:novel supercontig:loxAfr3:scaffold_68:4995272:5076706:-1 gene:ENSLAFG00000023166 transcript:ENSLAFT00000021700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL
QVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMT
PEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALG
LHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC
IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRL
LQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTE
EEKRLMEQKVLETEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEITTKPT
YLPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLN
ELKTEIEALKLKERETALDILHNENTDRGGTSSKHNTIKKLTLQSAKSRVAFFEEL
Download sequence
Identical sequences G3TQE3
ENSLAFP00000017759 ENSLAFP00000017759 XP_010597054.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]