SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000017785 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000017785
Domain Number 1 Region: 768-876
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-25
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 2 Region: 4-133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.24e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 241-356
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000129
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 359-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000212
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 647-764
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000336
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 173-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000318
Family EGF-type module 0.032
Further Details:      
 
Domain Number 7 Region: 133-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000909
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000017785
Domain Number - Region: 581-630
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.004
Family Growth factor receptor domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000017785   Gene: ENSLAFG00000022063   Transcript: ENSLAFT00000021909
Sequence length 954
Comment pep:novel supercontig:loxAfr3:scaffold_21:40533807:40622849:1 gene:ENSLAFG00000022063 transcript:ENSLAFT00000021909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVDECAQGLDDCHANALCQNTPTSYKCICKPGYQGEGRQCEDIDECGNELNGGCVHDCLN
IPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQHTCLNVMGSYECRCKEGFFLSDNQ
HTCIHRSEEGLSCMNKDHGCSHICKEAPRGSVACECRPGFELAKNQRDCILTCNHGNGGC
QHSCEDTATGPECTCHPQYKMHTDGRSCLEQEDTALEVMESNTTSVADGDKRVKRRLLME
TCAVNNGGCDRTCKDTSTGVHCSCPVGFTLQLDGKTCKDIDECQTHNGGCDHFCKNTVGS
FDCSCKKGFKLLTDEKSCQDVDECSLDRTCDHNCINHPGTFACACNKGYTLYGFTHCGDT
NECSINNGGCQQVCVNTLGGYECQCHSGHKLHWNKKDCVEVKGLLPSGTPHVSLHCGKSG
GGDRCFLRCHSGTQISSDVTTIRTSVTFKLNEGKCSLKKAELFPEGLRPVLPEKHSSVKE
SFRYANLTCSSGKQVPGAPGRPSTTKEMFITVEFELETNQKEVTASCDLSCIVKRTEKRL
RKAIRTLRKAAHREQFHLQLSGMDLEVAKKSPRTSELRAESCGVGQGHVESQCVNCRAGT
YYDGVQERCILCPNGTFQNEEGQITCEPCPRPENPGAPKTPEAWNVSECGGLCQPGEYST
DGFAPCQLCPLGTFQPEAGRTSCFPCGGGLPTKHLGAPSFQDCETRVQCSPGHFYNTTTH
RCIRCPAGTYQPEFGKNNCVSCPGNTTTDFDGSTNITQCKNRHCGGELGDFTGYIESPNY
PGNYPANTECTWTINPPPKRRILIVVPEIFLPIEDDCGDYLVMRKTSSSNSVTTYETCQT
YERPIAFTSRSKKLWIQFKSNEGNSARGFQVPYVTYDEDYQELIEDIVRDGRLYASENHQ
EILKDKKLIKALFDVLAHPQNYFKYTAQESREMFPRSFIRLLRSKVSRFLRPYK
Download sequence
Identical sequences G3TQG1
ENSLAFP00000017785 ENSLAFP00000017785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]