SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000017796 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000017796
Domain Number 1 Region: 144-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000383
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 2 Region: 64-183,278-286
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000847
Family Growth factor receptor domain 0.007
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000017796
Domain Number - Region: 202-232
Classification Level Classification E-value
Superfamily Fzo-like conserved region 0.0942
Family Fzo-like conserved region 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000017796   Gene: ENSLAFG00000022186   Transcript: ENSLAFT00000022076
Sequence length 291
Comment pep:novel supercontig:loxAfr3:scaffold_138:984700:986491:-1 gene:ENSLAFG00000022186 transcript:ENSLAFT00000022076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRIELCTLLSGLSFLLLPLPGEGAKGGSLKESHGVCSKQTLMVPLRYNESYSQPTYKP
YLTLCTGRRVCSTYRTVYHVAWREVRREVQQTHTVCCQGWKKRHPGALTCEAICTKPCQN
GGICVQPDQCECAPGWGGKHCHVDVDECRTSVTLCSHHCLNTVGSFTCSCPHGLGLGPDG
RTCAKGSQEPPTSTSILSVAIREVEHDEHTLRQEIRELRGRLEQLEQWAGQAGAWVRAVL
PVPPEELQPQQVAELWGRGDRIDSLSDQVLLLEEKLGTCSCEDNSLGPGLN
Download sequence
Identical sequences G3TQG9
ENSLAFP00000017796 ENSLAFP00000017796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]