SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000017969 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000017969
Domain Number 1 Region: 1-55
Classification Level Classification E-value
Superfamily GLA-domain 4.71e-19
Family GLA-domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000017969   Gene: ENSLAFG00000026190   Transcript: ENSLAFT00000025988
Sequence length 172
Comment pep:novel supercontig:loxAfr3:scaffold_4:8197235:8203556:-1 gene:ENSLAFG00000026190 transcript:ENSLAFT00000025988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NHWDLELLTPGNLERECREERCSWEEAREFFEDNTQTERFWETYIYNGKGEQKNIRRGRV
DIAGLAVGLTSGVLLVVLAGLGAFWYLRYRRGRGQHSCPQEQHTVHCSKSLGPLSPPSSL
GPPTPLPPPPGLPTYEQALEASGVHDAPPPPYSRGPSRAFGCCKEKKAIPPR
Download sequence
Identical sequences G3TQW1
ENSLAFP00000017969 ENSLAFP00000017969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]