SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000018146 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000018146
Domain Number 1 Region: 11-115
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.53e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000018146   Gene: ENSLAFG00000013742   Transcript: ENSLAFT00000030448
Sequence length 534
Comment pep:novel supercontig:loxAfr3:scaffold_21:2322059:2331385:1 gene:ENSLAFG00000013742 transcript:ENSLAFT00000030448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVEPSKTEIQTLFKRLRAIPTNKACFDCGAKNPSWASIPYGVFLCIDCSGVHRSLGVHV
SFIRSTELDSNWNWFQLRCMQVGGNANATAFFRQHGCTASDANTKYNSRAAQMYREKIRQ
MGSVALARHGTDLWIDNMSSAPSHSPEKKDSDFFTEHTQPPVWDAQATEPSETQQPVPPA
ESSGLARDGHGPNADLLATSPKASLESMFLSPQGALPARELKTSIIGKKKPAAAKKGLGA
KKGLGAQKVSSQSFSEIERQAQVAEKLREQQAADAKKQAEESMVASMRLAYQELQIDRKK
EEKKLQNLEGKKREQAERLGMGLVSRSSVSHSALSEMQVIEQETPASVRSSRSQLDLFDD
VGTFASGPPKYKDNPFSLGESFGSRWDTDATWGMDRVEEKEPEVTISSIRPISERATNRR
EIESRSSGLESSEARQKFAGAKAISSDMFFGREMDSEYEARSRLQQLSGSSAISSSDLFG
EVDGAHGAGSVSLGNVLPTADIAQFKQGVKSVAGKMAVLANGVMNSLQVRLGLL
Download sequence
Identical sequences G3TRD8
ENSLAFP00000018146 ENSLAFP00000018146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]