SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000018258 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000018258
Domain Number 1 Region: 37-171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.37e-35
Family Galectin (animal S-lectin) 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000018258   Gene: ENSLAFG00000018660   Transcript: ENSLAFT00000028228
Sequence length 172
Comment pep:novel supercontig:loxAfr3:scaffold_27:15536434:15540826:1 gene:ENSLAFG00000018660 transcript:ENSLAFT00000028228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCGGLLDSSRLVKLDDGHLNNSLGSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIV
DLNPESFAISLTCGDSEDPPADVAIELKAVFTERQLLRNSCISGERGEEQSAIPYFPFIP
DQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQLTKLG
Download sequence
Identical sequences G3TL88
ENSLAFP00000018258 ENSLAFP00000015639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]