SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000018433 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000018433
Domain Number 1 Region: 240-438
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.74e-47
Family Reprolysin-like 0.00022
Further Details:      
 
Domain Number 2 Region: 455-531
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 5.14e-19
Family Blood coagulation inhibitor (disintegrin) 0.00055
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000018433
Domain Number - Region: 686-713
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00134
Family Integrin beta EGF-like domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000018433   Gene: ENSLAFG00000011340   Transcript: ENSLAFT00000029876
Sequence length 776
Comment pep:novel supercontig:loxAfr3:scaffold_31:25879956:25897922:1 gene:ENSLAFG00000011340 transcript:ENSLAFT00000029876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLRGWAFAALLLLLPLLPPPSLEARGPAGALRWGSSPQVGDQEAPEVMEPSRLVGESS
GGEVRKQQLDTRVRQEPPGGPPVHLAQVSFVIPAFNSNFTLDLELNHHLLSSQYVERHFS
REGTTQHSTGAGDHCYYQGKLRGNPHSFAALATCQGLHGVFSDGNFTYIVEPREMAGPRE
ARQGPFPHLIYRTPLLPAPLGCREPGCLFAAPAHVAPLNQQKLRRKRQVRRGHPTVHSET
KYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDK
IQVQDDLLETLARLMVYRREGLPEPSDATHLFSGKTFQSTSSGAAYMGGICSMARGGGVN
EFGNVGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCPDIWLGCIMEDTGFYLPRKFSRCS
IDEYNQFLQEGGGSCLFNKPLKLLDPPECGNGFVEAGEECDCGSLQECSRTGGNCCKKCT
LTHDAMCSDGLCCRRCKYEPRGVSCREAVNECDIAETCTGDSSQCPPNLHKLDGYYCDHE
QGRCYGGRCKTRDRQCQALWGHAAADRFCYEKLNVEGTERGNCGRKGSGWVQCNKQDVLC
GFLLCVNISGVPRLGDLGGDISSVTFYHQGKELDCRGGHVQLADGSDLSYVEDGTACGPN
MLCLDHRCLPASAFNFSTCPGSGERQICSHHGVCSNEGKCICQPDWTGKDCSIHNPLPTS
PPTGETERYKGPSGTNIIIGSIAGAVLVAAIVLGGTGWGFKNIRRGRYDPTQQGAV
Download sequence
Identical sequences G3TS75
ENSLAFP00000018433 ENSLAFP00000018433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]