SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000018740 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000018740
Domain Number 1 Region: 658-769
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.62e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00039
Further Details:      
 
Domain Number 2 Region: 119-288
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.45e-33
Family G proteins 0.000002
Further Details:      
 
Domain Number 3 Region: 386-461,597-642
Classification Level Classification E-value
Superfamily PH domain-like 8.39e-17
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 4 Region: 781-871
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000933
Family Ankyrin repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000018740   Gene: ENSLAFG00000030437   Transcript: ENSLAFT00000036441
Sequence length 903
Comment pep:novel supercontig:loxAfr3:scaffold_12:59656349:59749099:1 gene:ENSLAFG00000030437 transcript:ENSLAFT00000036441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAGGGQSPQQQQSLAAPGGGGGGGAGGGGQFGGAVPGAGGGGGPSQQLAGGPPQQFALSN
SAAIRAEIQRFESVHPNIYAIYDLIERIEDLALQNQIREHVISIEDSFVNSQEWTLSRSV
PELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPP
ELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLCSFRNASEVPMVLVGTQDAISAANPRV
IDDSRARKLSTDLKRCTYYETCATYGLNVERVFQDVAQKVLALRKKQQLAIGPCKSLPNS
PSHSAVSAASIPSVHLNQATNGGSSAFSDYSSSVPSTPSISQRELRIETIAASSTPTPIR
KQSKRRSNIFTSRKGADVDRERKAADCKVDSIGSGRAIPIKQGILLKRSGKSLNKEWKKK
YVTLCDNGLLTYHPSLHDYMQNIHGKEIDLLRTTVKVPGKRLPRASPATASGTSPRANGL
ERSGTHLGGASGAPHSASSTCLHSDRPLGSSTLAGARPEGLPQRSCSVSSADQWSEATSL
PLGTPHPASGPAEVLSSSPKLEPPPSPHSNRKKHRRKKSTGTPRQDGPTSAAEDAEESFE
FVVVSLTGQTWHFEASTAEERELWVQSVQAQILASLQGCRSAKDKTRLGNQNAALAVQAV
RTVRGNSFCIDCDAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLDDWPPELLA
VMTAMGNALANSVWEGSLEGYAKPGPEACREEKERWIRAKYEQKLFLAPLPGSDVPLGQQ
LLRAVVEDDLRLLVTLLAHGSKEEVNETYGDGDGRTALHLSSAMANVVFTQLLIWYGVDV
RSQDARGLTPLAYARRAGSQECADILLQHGCPGEGCGLAPTPSREPTSGTNTSAELHRSP
SLL
Download sequence
Identical sequences G3TT32
ENSLAFP00000018740 ENSLAFP00000018740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]