SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000018773 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLAFP00000018773
Domain Number - Region: 5-37
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0706
Family EGF-type module 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000018773   Gene: ENSLAFG00000029677   Transcript: ENSLAFT00000033023
Sequence length 117
Comment pep:novel supercontig:loxAfr3:scaffold_0:89850348:89857760:1 gene:ENSLAFG00000029677 transcript:ENSLAFT00000033023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TADKADPCKFLACGKFAQCVMNEWTKEAECRCRPRYERQGGLDHLDPRLCGPEEKCEVTQ
GKGATCSRKEGREGERYSISFQEGDGDLNNLKHNQEKHSESLTAGHEEFNHQDGERN
Download sequence
Identical sequences G3TT65
ENSLAFP00000018773 ENSLAFP00000018773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]