SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000018859 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000018859
Domain Number 1 Region: 153-349
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-38
Family SPRY domain 0.00029
Further Details:      
 
Domain Number 2 Region: 12-82
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000303
Family RING finger domain, C3HC4 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000018859   Gene: ENSLAFG00000026684   Transcript: ENSLAFT00000031163
Sequence length 352
Comment pep:novel supercontig:loxAfr3:scaffold_122:2295274:2299144:-1 gene:ENSLAFG00000026684 transcript:ENSLAFT00000031163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPALGSGLVERLEQLATCPLCGGPFKDPVLLACEHSFCRACLALRWGPPPATGTAATP
TACPCCGRPCPRRSLRSNVRLAVEVRISRGLCEKLAEPGARAVRRRGGRIPTMGWLDPPG
EDMRKTWSRFDAPMPKSPNSEDDLPEDYPVVKNMLHRLTADLTLDPGTAHRHLVISSDCR
SVRLAPPGTPAPPDSPARFDQLPAVLGAQGFGAGRHCWEVETTDTVSREDSSGEDEDDGE
SRYAVGAAGESVRRKGRVGLCPAGAVWAVEGRGGRLWALTAPEPTLLGGAGPPPRRIRVD
LDWERGRVAFYDGRSLDLLFAFQAPGPLGERVFPLLCTRDPRAPLRIVPAEG
Download sequence
Identical sequences G3TTF1
ENSLAFP00000018859 ENSLAFP00000018859 XP_010599504.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]