SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000019683 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000019683
Domain Number 1 Region: 110-255
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-46
Family C-type lectin domain 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000019683   Gene: ENSLAFG00000026544   Transcript: ENSLAFT00000034879
Sequence length 259
Comment pep:novel supercontig:loxAfr3:scaffold_114:1901983:1904777:-1 gene:ENSLAFG00000026544 transcript:ENSLAFT00000034879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SREEQRMEEMDDHNDPDSHEEKVTFWGQRFMKKDPRFLRSHDPGTGGCLTQVPLPLLLLV
SLGLVFVFLVTTLVQVFRIHQALQSETWDHQNASPLLPVASPQKQIQLELEEIHQQLAWM
NASLAGLCNPCSRNWESFQNSCYFLSRTRGTWDTSVTACQDQGAQLVIINSVEEQRFLQF
WIVGKDTRTWIGLSDHHNEGAWHWVDNTKLQLSFWTEGEPNNVGDEDCAEMIAAGWNDNK
CTAENFWVCEKPSTPCPGV
Download sequence
Identical sequences G3TVS5
ENSLAFP00000019683 ENSLAFP00000019683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]