SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000019914 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000019914
Domain Number 1 Region: 289-449
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-47
Family SPRY domain 0.0000662
Further Details:      
 
Domain Number 2 Region: 2-77
Classification Level Classification E-value
Superfamily RING/U-box 1.79e-19
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 93-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000137
Family B-box zinc-binding domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000019914
Domain Number - Region: 153-249
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0275
Family C-terminal domain of PLC-beta 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000019914   Gene: ENSLAFG00000023305   Transcript: ENSLAFT00000021784
Sequence length 465
Comment pep:novel supercontig:loxAfr3:scaffold_276:162894:166494:1 gene:ENSLAFG00000023305 transcript:ENSLAFT00000021784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVTAALAGIQAEANCPICLDYFRDPVTIKCGHNFCCSCIQQSWEGRQDRFPCPECRHPC
LHWHLGSNTQLGHIAEIAKLLHITRSKRKREEETRLCEKHNQVLTHFCEEDLEVLCPLCT
QLPDHQDHYVRSIEEAASHHRKRLMSYMEPLKKQMAHFQKLVTTQDREPFALRKKVEKQR
KKLFSEFEHLNKFLDREHEAALSRLAREEKHVQQKLNANITAFSESISTLNSLLKEVAEK
SVMSEGKLLTDIKSVQDRCESLNPPVLYSFQLTKEGCSLPPQYSALQKIIQKFKDVALDP
ETPHYKKSVTFVKKTQRLPPNPKRFKFDPVVLGCEEFSSGRHYWEVEVGEKPEWSVGLCK
DSLSRKAKRPPAGQERCWAIHLCNGNYVAQGTFPVTLVMTEKPRGIGIYLDYELGEISFY
SLNDRSHIFSFTDRFSEILKPYFCIGHTVSGQLTTSFLVTFWTKV
Download sequence
Identical sequences G3TWF6
ENSLAFP00000019914 ENSLAFP00000019914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]