SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000019971 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000019971
Domain Number 1 Region: 22-218
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.16e-38
Family Pentraxin (pentaxin) 0.000000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000019971   Gene: ENSLAFG00000020848   Transcript: ENSLAFT00000020600
Sequence length 219
Comment pep:novel supercontig:loxAfr3:scaffold_33:8572199:8575916:1 gene:ENSLAFG00000020848 transcript:ENSLAFT00000020600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLLLGVLFPTILSGAVTHSDLRGKAFIFPQESDTAYVSLIPRVKRPLQNFTLCLKAFT
DLTRPYSLFSYSTQSQANELLLFVNKMGEYILYIGNVGATFKAPESPYAPIRVCATWESA
SGIAELWVNGKPLGRKGLKKGYSVGAEAKIILGQEQDSFGGKFDAKQSLVGEIWDVSLWD
RVLSLKEVGASRYNGNVLNWQALHYEASGYVVIKPKVWV
Download sequence
Identical sequences G3TWL3
XP_003415221.1.64505 ENSLAFP00000019971 ENSLAFP00000019971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]