SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020073 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020073
Domain Number 1 Region: 30-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000653
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 87-144
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000264
Family Complement control module/SCR domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020073   Gene: ENSLAFG00000025947   Transcript: ENSLAFT00000033719
Sequence length 194
Comment pep:novel supercontig:loxAfr3:scaffold_13:12576138:12587474:1 gene:ENSLAFG00000025947 transcript:ENSLAFT00000033719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQMLQSSFPALYLVGALILLQCPLALCGCKIPPSIAHGSYKYVNTILLFPAEVEYKCDE
GYVLVGKAKITCTFSSWSSPAPQCKALCLKPEIENGKLYVDKDQYVETENVIIKCDPGYG
VVGLQSITCSENRTWYPEVPKCEWEAPEGCKQVLSGRYLMQCLPRPQDVKMALEVYKLSL
EIEQLARRVGLEEE
Download sequence
Identical sequences G3TWW5
ENSLAFP00000020073 ENSLAFP00000020073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]