SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020095 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020095
Domain Number 1 Region: 397-539
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-40
Family Third domain of FERM 0.0000101
Further Details:      
 
Domain Number 2 Region: 293-398
Classification Level Classification E-value
Superfamily Second domain of FERM 1.07e-35
Family Second domain of FERM 0.00000398
Further Details:      
 
Domain Number 3 Region: 213-292
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.86e-26
Family First domain of FERM 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020095   Gene: ENSLAFG00000023093   Transcript: ENSLAFT00000025877
Sequence length 989
Comment pep:novel supercontig:loxAfr3:scaffold_0:29654202:29780256:1 gene:ENSLAFG00000023093 transcript:ENSLAFT00000025877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEVGSASEVKKESDQIGADAAKEKPKEVAENQQNQSSDPEEEKGPQPPPAAESQSSPR
RQKREKDPSESRGISRFIPPWLKKQKSYNLVVAKDGGDKKGPTQAVVEEQIIDKEESLPR
EERQAKGDAEETAQRKQQEIKAQVKEEQPSVSVAEAQLAKGESKEREDEKEKEIQEEKPE
GEAAKRETKEVQTNELRADKISQKATKKTKTVQCKVILLDGTEYSCDVEKGAKGQVLFDK
VCERLNLLEKDYFGLLFQENSEQKNWLDPAKEIKRQLRNLPWLFTFNVKFYPPDPSQLTE
DITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDPEEHSPDVVSDFQFAPT
QTKELEEKVAELHKTHRGLSPAQADSQFLENVKRLSMYGVDLHHAKDSEGVDIKLGVCAN
GLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWK
VCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQASILIDRPAPHFDRTSSKR
VSRSLDGDQSLMKDFSGPPGEISAYGPGVVSPVGIQDGDGRSCLFPPVCDLISQKNSLRV
EGDNIYVRHSNLMLEDLDKAQEDILKHQASISELKRNFMESTPEPRPNEWEKRRITPLSL
QTQGSSHETLNVVEEKKQAEVGKDERVITEEMNGKEISPGSGPGEIRKVEPLTQKDSTSL
SSESSSSSESEEEEVGEYRPYHRVTEGTVREEQEEYEEETEEEPGRAAKVVEREEAVPEA
SPVKQAGANLITIETVIQENVVAQKISGEKSVNEGTVNKQDMREETEEEQHKVNGEVSHV
DIDVLPQIICCSEPPVVKTEMVTISDASQRTEISTKEVPIVQTETKTITYESPQVQKRAG
DDSGTLVSAQTITSDSVSTTTTTHITKTVKGGISETRIEKRIVITGDGDIDHDQALAQAI
KEAREQHPDMSVTRVVVHKETELAEEGED
Download sequence
Identical sequences G3TWY7
ENSLAFP00000020095 ENSLAFP00000020095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]