SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020126 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020126
Domain Number 1 Region: 112-236
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-30
Family SPRY domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020126   Gene: ENSLAFG00000032186   Transcript: ENSLAFT00000035464
Sequence length 236
Comment pep:novel supercontig:loxAfr3:scaffold_110:2224695:2228754:1 gene:ENSLAFG00000032186 transcript:ENSLAFT00000035464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVKVQERKQRTVAEFEKFRQLLAEEELRVLRELEEEEAAVVEVLRQEESTLAAQGRSVEE
LISELEGRTERPALGLLQGIGEILSRIKRLELQTPKAISMELKTVCKVPGLVETLRRFQV
VVTLDPKSAHPCLTLSEDQRSVLQTRPWNGQPGAEGLFGVFPSVLGSEQLSAGRHYWEVE
VRDRGRWLIGVCKEDADRKNSPTWTSGYGFWSKGDLFPAGVFSPQKTPHPRVGVFL
Download sequence
Identical sequences G3TX18
ENSLAFP00000020126 ENSLAFP00000020126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]