SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020172 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020172
Domain Number 1 Region: 88-272
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-61
Family SPRY domain 0.00000152
Further Details:      
 
Domain Number 2 Region: 3-76
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000191
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020172   Gene: ENSLAFG00000021491   Transcript: ENSLAFT00000022687
Sequence length 274
Comment pep:novel supercontig:loxAfr3:scaffold_6:66784088:66784909:-1 gene:ENSLAFG00000021491 transcript:ENSLAFT00000022687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKHFEEASRCPMCPAYNENPMYLKCGYLCCLQCINSLQKEPHGEGVLCPVCPVVSQKDD
IRSNFQLGKLISKIMELEPQMKKILKMNPRMLRFQVDMILDVDTANNLLTISADLRTVRC
GRFKHQLTEHVERFDYALCVLGSTRFTSGRHYWEVDVGTSQDWVLGVCRESARRKGKIQL
STERGFWTVGLRKGGYFFASITPALELCVDPNLGRVGIFLDMDMGSLSFFNMSDGSHVFT
FTEISASQTLRPFFGPSVSSNGHQGSLSICPVMN
Download sequence
Identical sequences G3TX64
ENSLAFP00000020172 ENSLAFP00000020172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]