SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020359 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020359
Domain Number 1 Region: 16-154
Classification Level Classification E-value
Superfamily C-type lectin-like 1.07e-22
Family C-type lectin domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020359   Gene: ENSLAFG00000010149   Transcript: ENSLAFT00000025465
Sequence length 233
Comment pep:novel supercontig:loxAfr3:scaffold_3:68188816:68204566:1 gene:ENSLAFG00000010149 transcript:ENSLAFT00000025465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKLLRLSKLLLCIVALAIMLDCPSSIWVQFQDNCYIFLQEAIKVESIEDVRNQCTDHGAD
MISIHNEEENAFILNTLKKQWKGPADILLGMFYDTDDACFKWFDKSNMTFAKWTDQDDGE
DLVDTCAFLHTKTGEWKKGNCEVSSVEGTLCKAAMPYEKKYLSGNHLDNILISALVIAST
VILTVLGAIIWFLYKRNSDSGFTTVFSSAPQSPYNDDCVLVVAEENECNAQFD
Download sequence
Identical sequences G3TXQ1
ENSLAFP00000020359 ENSLAFP00000020359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]