SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020470 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020470
Domain Number 1 Region: 1-44
Classification Level Classification E-value
Superfamily GLA-domain 0.000000000000387
Family GLA-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020470   Gene: ENSLAFG00000027978   Transcript: ENSLAFT00000033560
Sequence length 189
Comment pep:novel supercontig:loxAfr3:scaffold_111:1980505:1981436:1 gene:ENSLAFG00000027978 transcript:ENSLAFT00000033560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSCMEEICSYEEVKEVFEDKEQMMEFWKGYPNAVYSVRNPDTMYVVVPLLGVALLIVIAL
FIIWRCQLQKATRHHPSYAQNRYLASRAGHSLPRVMVYRGTVHGLAESSGHREAGSNPHV
VLGPSRGVRTTVRLENTLYLPELSLSRLSSATPPPSYEEVTAPQESSSEEASVSYSDPPP
KYEEIVAAN
Download sequence
Identical sequences G3TY12
ENSLAFP00000020470 ENSLAFP00000020470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]