SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020492 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020492
Domain Number 1 Region: 4-73
Classification Level Classification E-value
Superfamily RING/U-box 9.28e-20
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 2 Region: 90-149
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000011
Family B-box zinc-binding domain 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000020492
Domain Number - Region: 135-238
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00876
Family Apolipoprotein 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020492   Gene: ENSLAFG00000029136   Transcript: ENSLAFT00000031111
Sequence length 292
Comment pep:novel supercontig:loxAfr3:scaffold_37:193751:194646:1 gene:ENSLAFG00000029136 transcript:ENSLAFT00000031111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAALAELQAEANCSVCLDYLRDPVTIECGHNFCRSCIEQSWEDQQDRFPCPVCCHPSQKW
HLRRNTQLGNIGEVAKLLHITRSKKKKEEETRLCEKHNQVLTHFCEEDLEVLCLLCTQVP
GHQDHHVRSLEEAASHHRKRLMSYMEPLKKQVADIQKLVTTQEREPLELKEKMEKQRQKL
LSEFEHLNEFLDREQEATFSRLANEEKHIQQKLHANITAFSEYISTLNNLLKEVAGKSVM
SEVKLLTDIESICDRCESLKTPLSIPSSLPLQYSALQKIIQKFKEDVTLDTE
Download sequence
Identical sequences G3TY34
ENSLAFP00000020492 ENSLAFP00000020492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]