SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020734 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020734
Domain Number 1 Region: 24-180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-32
Family Laminin G-like module 0.0041
Further Details:      
 
Domain Number 2 Region: 200-235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000301
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020734   Gene: ENSLAFG00000030591   Transcript: ENSLAFT00000027576
Sequence length 262
Comment pep:novel supercontig:loxAfr3:scaffold_9:54323528:54326875:1 gene:ENSLAFG00000030591 transcript:ENSLAFT00000027576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFTFHSVFFTLKVSILLGSLLGLCLGLEFMGLPNQWARYLRWDASTRSDLSFQFKTNVS
TGLLLYLDDGGVCDFLCLSLVDGRVQLRFSMDCAETAVLSNKQVNDSSWHFLMVSRDRLR
TVLVLDGEGQSGELQPQRPYMDVVSDLFIGGVPADIRPSALTLDGVQAVPGFKGFILDLK
YGNSEPRLLGSQGVQLDAEGPCSERPCENGGICFLLDGHPTCDCSTTGYSGKLCSEDGGM
AQGAGLDHHFLQEDSLCCVCIR
Download sequence
Identical sequences G3TYS6
ENSLAFP00000020734 ENSLAFP00000020734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]