SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000021000 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000021000
Domain Number 1 Region: 3-171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.81e-34
Family Laminin G-like module 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000021000
Domain Number - Region: 176-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00587
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000021000   Gene: ENSLAFG00000032549   Transcript: ENSLAFT00000033569
Sequence length 208
Comment pep:novel supercontig:loxAfr3:scaffold_91:1256326:1299569:-1 gene:ENSLAFG00000032549 transcript:ENSLAFT00000033569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NYWNAASFPDPSSHLHFSTFQGETSADISFYFKTLIPRGVFLENLGNTDFIKLELKSATD
VSFSFDVGNGPVEIVVRAPSPLNDDQWHRVTAERNVKQASLQVDRLPPQVRKAPTEGHRR
LELYSQLYVGAAGGQQGFLGCIRSLRMNGVTLDLEERAKVTSGFVSGCSGHCTSYGANCE
HGGRCVEKYHGYSCDCTHTAYEGTFCNK
Download sequence
Identical sequences G3TZJ2
ENSLAFP00000021000 ENSLAFP00000021000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]