SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000021200 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000021200
Domain Number 1 Region: 291-467
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-59
Family SPRY domain 0.0000204
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily RING/U-box 1.75e-21
Family RING finger domain, C3HC4 0.0094
Further Details:      
 
Domain Number 3 Region: 96-155
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000824
Family B-box zinc-binding domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000021200
Domain Number - Region: 141-244
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0262
Family Apolipoprotein 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000021200   Gene: ENSLAFG00000032521   Transcript: ENSLAFT00000026347
Sequence length 468
Comment pep:novel supercontig:loxAfr3:scaffold_37:17409:18812:1 gene:ENSLAFG00000032521 transcript:ENSLAFT00000026347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSLMEVMEVLAGIRAEANCLICMDYFRDPVTIKCGHNFCRSCIEQSWEDQQDWFRCPVCH
HPWLQLHLRSNTQLGNIAEIAKLLHITRSKRKREEETRLCKKHNQVLTHFCEEDLEVLCS
LCTQPPNHQDHLMRSIEEAASHHRKRLMSYMEPLKKQVADFQKLITSQEREPSELRKKVE
KQRKELFSEFEHLNKFLDREHEAALSRLAYEEKHIQQKLNANITAFSESISTLNNLLKEV
AEKSVMSEVKLLTDIQSVQNRCEGLNPPVLYSFQLTKEGCSLPPQYSALQKIIQKFKEDV
TLDPETAHSNLIVSEDKKSVTFVKKTQRLPPNPKRFKFDPVVLGCEEFSSGRHYWEVEVG
EKPEWSVGLCKDSLSRKAKRPPAGQERCWAIQLCNGNYVARGTFPVTPVITEQPRGIGIY
LDYELGEISFYSLNDRSHIYSFTDRFSEILKPYFCIERDSQPLTICAV
Download sequence
Identical sequences G3U042
ENSLAFP00000021200 ENSLAFP00000021200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]