SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000021357 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000021357
Domain Number 1 Region: 77-281
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-54
Family SPRY domain 0.0000146
Further Details:      
 
Domain Number 2 Region: 36-87
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000283
Family F-box domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000021357   Gene: ENSLAFG00000015751   Transcript: ENSLAFT00000031511
Sequence length 284
Comment pep:novel supercontig:loxAfr3:scaffold_25:17356530:17369001:-1 gene:ENSLAFG00000015751 transcript:ENSLAFT00000031511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPTPGAGGASGGAGCSGAGAGAGSGSGSAGAGGRLPSRVLELVFSYLELSELRSCALV
CKHWYRCLHGDENSEVWRSLCARSLAEEALRTDILCNLPSYKAKVRAFQHAFSTNDCSRN
VYIKKNGFTLHRNPIAQSTDGARTKIGFSEGRHAWEVWWEGPLGTVAVIGIATKRAPMQC
QGYVALLGSDDQSWGWNLVDNNLLHNGEVNGSFPQCNNAPKYQIGERIRVILDMEDKTLA
FERGYEFLGVAFRGLPKACLYPAVSAVYGNTEVTLVYLGKPLDG
Download sequence
Identical sequences G3TFS4
XP_003412990.1.64505 ENSLAFP00000021357 ENSLAFP00000013211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]