SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000021707 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000021707
Domain Number 1 Region: 4-99
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-24
Family Galectin (animal S-lectin) 0.0000956
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000021707   Gene: ENSLAFG00000022180   Transcript: ENSLAFT00000022243
Sequence length 150
Comment pep:novel supercontig:loxAfr3:scaffold_99:2958261:2962844:1 gene:ENSLAFG00000022180 transcript:ENSLAFT00000022243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVEVPYTLHLSLSIGSSVTIRGKPAVSFSKDPQMQVDFHTGTSEKSDIAFHFRVYFGHRV
VMNSLQAGGWKREVAVSHMLFSDGQHFDLRFLVLQNEYQGLCSFAVKQYVAMEIKYSTSL
AILGFHAFPPPPKLTQKKNQGLPRYVAVKL
Download sequence
Identical sequences G3UB87
ENSLAFP00000021707 ENSLAFP00000025095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]