SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022057 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000022057
Domain Number 1 Region: 26-188
Classification Level Classification E-value
Superfamily RUN domain-like 1.05e-45
Family RUN domain 0.0000405
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022057   Gene: ENSLAFG00000010950   Transcript: ENSLAFT00000033213
Sequence length 451
Comment pep:novel supercontig:loxAfr3:scaffold_5:61640605:61727232:-1 gene:ENSLAFG00000010950 transcript:ENSLAFT00000033213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRSLGGLSGSRGSKKSLSARNAAVERRNLITVCRFSVKTLIDRSCFETIDDSSPEFNN
FAAILEQILSHRLKGQVTWFGYESPRSFWDYIRVACRKVSQNCICSIENMENVNSSRAKG
RAWIRVALMEKHLSEYISTALRDFKTTRRFYEDGAIVLGEEANMLAGMLLGLNAIDFSFC
LKGEGLDGNFPAVIDYTPYLKFTQSSDSISSDEEELRTLGSSGSESSTPETVGPPFIMDE
NSWFNKCKRVKQKYQLTLEQKGYLEELLRLRENQLSESVSQNKILLQRIEDSDLAHKLEK
EQLEYIIVELQDQLTVLKNNDLRSRQELTAHLTNQWPSPGALDVNAVALDTLLYRKHNKQ
WYEKSYQSLDQLSAEVSLSQTSLDPGQSQEGDGKQDTLNLITEGKEDTPSLLGLCGSLTS
VASYKSLTSLKSNDYLASPTTEMTSPGLTPS
Download sequence
Identical sequences G3T6K0
XP_003407212.1.64505 ENSLAFP00000009157 ENSLAFP00000022057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]