SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022218 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000022218
Domain Number 1 Region: 31-125
Classification Level Classification E-value
Superfamily Immunoglobulin 1.34e-38
Family V set domains (antibody variable domain-like) 0.0000378
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022218   Gene: ENSLAFG00000027951   Transcript: ENSLAFT00000030291
Sequence length 149
Comment pep:novel supercontig:loxAfr3:scaffold_202:304503:305211:1 gene:ENSLAFG00000027951 transcript:ENSLAFT00000030291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHQAGRGSKMVPHTLVLMSLLLWVSGASGDTVLTQSPASLAKSQGETVTINCKASQSVSS
NYLSWYQQKPGQAPKLLMYRASSRASGVPDRFSGSGSGTDFTFTISNFQAEDAAVYYCQQ
GYNNPAPTVLQPRTKTSSPGAKGHPESSR
Download sequence
Identical sequences G3U310
ENSLAFP00000022218 ENSLAFP00000022218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]