SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022232 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000022232
Domain Number 1 Region: 265-346
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.1e-21
Family Complement control module/SCR domain 0.00000461
Further Details:      
 
Domain Number 2 Region: 84-146
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000433
Family Complement control module/SCR domain 0.0000464
Further Details:      
 
Domain Number 3 Region: 204-262
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000616
Family Complement control module/SCR domain 0.0000336
Further Details:      
 
Domain Number 4 Region: 22-94
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000459
Family Complement control module/SCR domain 0.0000656
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000022232
Domain Number - Region: 153-199
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00144
Family Complement control module/SCR domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022232   Gene: ENSLAFG00000026955   Transcript: ENSLAFT00000028182
Sequence length 346
Comment pep:novel supercontig:loxAfr3:scaffold_49:15228711:15241002:-1 gene:ENSLAFG00000026955 transcript:ENSLAFT00000028182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISWVLIFFSSFLWHVAIAGRTCPRPEEVPFAIVLPLKSFYDPGEQITYTCQPGYVARGG
VMRRFTCPLTGMWPVNTLKCLPRVCPFAGILENGAVRYTTFEYPNTISFTCNTGFQLNGT
KSAKCTEEGRWNPGLPVCARESVGPFTMPVFFYACSYNPMCGNNSLYRDTAVFACLPHHA
IFGNDTISCTELIDWTQLPEGREVKCPFPSRPDNGFVNYPAKQVLYYKDKATYGCHDTFA
LDGPEEVECSKLGTWSAQPSCKASCKLSVKKATVLFQGERVKLQERFKNGMLHGEKVSFF
CKNKEKKCSYTEDAQCIDGTIEIPKCFKEHSSLAFWKTDASDVKPC
Download sequence
Identical sequences G3TRI4
ENSLAFP00000018192 ENSLAFP00000022232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]