SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022290 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000022290
Domain Number 1 Region: 255-385
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-29
Family C-type lectin domain 0.00098
Further Details:      
 
Domain Number 2 Region: 105-246
Classification Level Classification E-value
Superfamily C-type lectin-like 1.33e-27
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 3 Region: 2-94
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000000787
Family C-type lectin domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022290   Gene: ENSLAFG00000031408   Transcript: ENSLAFT00000035120
Sequence length 388
Comment pep:novel supercontig:loxAfr3:scaffold_3:67943217:67975462:1 gene:ENSLAFG00000031408 transcript:ENSLAFT00000035120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFEQAFITSLISSVVKTKDSYFWIALQDQNGTGEYTWKAAGQKSEPVQYTHWNAHQPRYS
GGCVVMRGRSPPGRWEVKDCRQFKAMSLCKQPLEIRGKNEHEERWPFHPCYLGWESEPGL
ASCFKVFHSEKVLMKRTWREAEAFCEEFGAHLASFAHTEEENFVNELLHSKFNWTEERQF
WIGFNKRNPQNADSWEWSDGTPVVSSFLDNTYFGEDVRNCAVYKANKKLLPLQCGSKREW
ICKIPRDVKPKIPQWYRHDEPWLFYQDTEYLFHTSPSEWASFEFVCSWLHSDPLTIHSAR
EQEFIHSKIKALSKFGVNWWIGLREERASDEFRWRDGTPLIYKNWDKERERPVNNQSQRC
GFISSITGLWGSEECSASMPSICKRKKF
Download sequence
Identical sequences G3U382
ENSLAFP00000022290 ENSLAFP00000022290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]