SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022307 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000022307
Domain Number 1 Region: 2-36
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022307   Gene: ENSLAFG00000029177   Transcript: ENSLAFT00000028687
Sequence length 40
Comment pep:novel supercontig:loxAfr3:scaffold_3:87576012:87576131:1 gene:ENSLAFG00000029177 transcript:ENSLAFT00000028687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQVCDPGEFLCHDHVTCVAQSWLCDGDPDCPDDSDESLDT
Download sequence
Identical sequences G3U399
ENSLAFP00000022307 ENSLAFP00000022307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]