SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022329 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000022329
Domain Number 1 Region: 468-609
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.33e-22
Family MAM domain 0.0009
Further Details:      
 
Domain Number 2 Region: 137-252
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000565
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 260-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000503
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000022329
Domain Number - Region: 77-104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0446
Family EGF-type module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022329   Gene: ENSLAFG00000005763   Transcript: ENSLAFT00000035505
Sequence length 609
Comment pep:novel supercontig:loxAfr3:scaffold_14:14028219:14107373:1 gene:ENSLAFG00000005763 transcript:ENSLAFT00000035505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFLLALVLASSLYLQAAAEFDGRWPRQVVSSIGLCRYGGRIDCCWGWARQSWGRCQPFY
VLRQRIARIRCQLKAVCQPQCKHGECVGPNKCKCYPGYAGKTCNQDEQFYPTPLDQGSEQ
PLFQPSDHQATSLPSRDLNECGLKPRPCKHRCMNTYGSYKCYCLNGYMLMPDGSCSSALT
CSMANCQYGCDVVKGQIRCQCPSPGLQLAPDGRTCVDIDECVTGRASCPRFRQCVNTFGS
YICKCHKGFDLMYIGGKYQCHDIDECSLGQHQCSSFARCYNVHGSYKCKCKDGYQGDGLT
CLYIPKVMIEPSGPIHVPKGNGTVLKGDGGHSNWIPEVGSTKWPLKTPYIPPVITYRPTS
KPTTRATPKPTPQPTLPLPLPPSTEFRTPPPPTPPKRPTTRLTTITPVTSTSPRGITVDN
RIQTEPQKPRGDVFIPRQPSNDLFEIFEIERGVSADDEAKDDPGVLIHSCNFDHGLCGWI
REKDNDLHWEPIRDAAGGQYLTVSAAKGPGGKAARLVLPLGHLMHSGDLCLSFRHKVTGL
HSGTLQVFVRKHGAHGAALWGRNGGHGWRQTQITLRGADVKSVIFKGEKRRGHTGEIGLD
DVSLKKGHC
Download sequence
Identical sequences G3UG33
ENSLAFP00000022329 ENSLAFP00000026791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]