SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022348 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLAFP00000022348
Domain Number - Region: 4-27
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0379
Family Moesin tail domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022348   Gene: ENSLAFG00000028035   Transcript: ENSLAFT00000036009
Sequence length 85
Comment pep:novel supercontig:loxAfr3:scaffold_22:1645078:1645335:1 gene:ENSLAFG00000028035 transcript:ENSLAFT00000036009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLQDQQLARQLMRLRSDINKLKIEQTCHLHRRMLNDATYELEERDELSDLSCDSPLASP
FSLSTPLKLIGVTKMNINSRRFSLC
Download sequence
Identical sequences G3U3E0
ENSLAFP00000022348 XP_010590634.1.64505 ENSLAFP00000022348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]