SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022613 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000022613
Domain Number 1 Region: 660-837
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 230-346
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.35e-33
Family Pyk2-associated protein beta ARF-GAP domain 0.001
Further Details:      
 
Domain Number 3 Region: 5-114
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-25
Family Pleckstrin-homology domain (PH domain) 0.00076
Further Details:      
 
Domain Number 4 Region: 971-1126
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000134
Family Pleckstrin-homology domain (PH domain) 0.042
Further Details:      
 
Domain Number 5 Region: 138-231
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000956
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 6 Region: 560-686
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000143
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 7 Region: 506-542
Classification Level Classification E-value
Superfamily PH domain-like 0.0000139
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000022613
Domain Number - Region: 872-955
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00217
Family Ras-binding domain, RBD 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022613   Gene: ENSLAFG00000004476   Transcript: ENSLAFT00000036045
Sequence length 1144
Comment pep:novel supercontig:loxAfr3:scaffold_79:7060066:7073116:1 gene:ENSLAFG00000004476 transcript:ENSLAFT00000036045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIPELPPHPMDGLPGGPAPVTPVIKAGWLDKNPPQGSYIYQKRWVRLDAEHLRYFDSNKD
AYSKRFIPVACISRVAAIGDQKFEVITNNRTFAFRAESDGERKEWMQVLQQAVADQRARA
RLSSANLLGVRGPELPDRAGSLELRGFKNKLYVAVVGDKVLLYKNLEEYHLGIGITFIDM
SVGNVKEVDRRSFDLTTPYRIFSFSAESELEKEQWLEAMQGAIAEALSTSEVAERIWAVA
ANRFCADCGAAQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTETLIELF
LQLGNGAGNRFWAANVPPSEALKPSSSPGARRRHLEAKYREGKYRCYHPLFGNQEELDKA
LCAAVTTTDLAETQALLGCGAGVSCFSGDPEAPTPLALAEQAGQTLQMEFLRNNQTTELP
RLDSMKPLEKHYSVVLPTVSHSGFLYKTASAGKPLQDRRAREGGVPSELWQVRADKRAVW
RGWRRAVMRVGVNWGRRLDLSSSLIYSFEHTFEVYTEGERLYLFGLESAELAREWVKCIA
KAFVPPLAEELLARDFDRLGRLPYKAGLSLQRTQEGWFSLTGSELHAIFPEGPCEEPLQL
RKLQELSVQGDSENQVLVLVERRRTLYIQGERRLDFTGWLGAIQKAAASSGDTLSEQQLG
DSNIPVIVYRCVDYITQCGLTSEGIYRKCGQTSKTQRLLESLRQDARSVRLKEGEQHVDD
VSSALKRFLRDLPDGLFTRAQRVAWLEASEIEDEEEKVSKYQELQARLPPVNRATVKALI
SHLYCVQCFSDTNQMNTHNLAIVFGPTLFQTDGQDYKAGRVVEDLISHYVVVFRVDEEEL
RKQWEEITAIVKMRVAGTASGTQHAGDFICTVYLEEKAAETEQHIKVPASMTAEELTMEI
LDRRNVGIREKDYWTCFEVNEREEAERPLHFAEKVLPILHGLGTDSYLVVKKHQSMEAMM
LYLASRVGDTKHGMMKFREDRSLLGLGLPSGGFHDRYFILNRSCLRLYKEVRSQRPWSGA
PETSHRPEKEWPIKSLKVYLGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCCDTQMELRE
WFATFLFVQHDGLVWPSEPSRVSRVAPEVRLGSVSLIPLRGNENEMRRSVAAFAADPLSV
SRSP
Download sequence
Identical sequences G3SUC3
ENSLAFP00000003737 ENSLAFP00000022613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]