SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022647 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000022647
Domain Number 1 Region: 63-128
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 6.93e-16
Family Ovomucoid domain III-like 0.0046
Further Details:      
 
Domain Number 2 Region: 256-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000838
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 3 Region: 164-221
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000036
Family Ovomucoid domain III-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022647   Gene: ENSLAFG00000007664   Transcript: ENSLAFT00000031639
Sequence length 366
Comment pep:novel supercontig:loxAfr3:scaffold_6:58741591:58798688:-1 gene:ENSLAFG00000007664 transcript:ENSLAFT00000031639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLPAAPPLAFCCYTSMLLLFAFSLPGSRASNQPPGGGSSGAGSGGFSSFTELNVRESDVR
VCDESSCKYGGVCKEDGDGLKCACQFQCHTNYVPVCGSNGDTYQNECFLRRAACKHQREI
TVVARGPCYSDNGSGSGEGAEEEGSGTEVHRKHSKCGPCKYKAECDEDAENVGCVCNIDC
SGYSFNPVCASDGSSYNNPCFVREASCIKQEQIDIRHLGHCTDTDDTSLLGKKDDGLQYR
PDVKDASDQREDVYIGNHMPCPENLNGYCIHGKCEFIYSTQKASCRCESGYTGQHCEKTD
FSILYVVPSRQKLTHVLIAAIIGAVQIAIIVAIVMCITRKCPKNNRGRRQKQNLGHFPSD
TSSRMV
Download sequence
Identical sequences G3T0F3
ENSLAFP00000022647 ENSLAFP00000006443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]