SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022846 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000022846
Domain Number 1 Region: 31-168
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.44e-38
Family Galectin (animal S-lectin) 0.00021
Further Details:      
 
Domain Number 2 Region: 196-321
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000127
Family Galectin (animal S-lectin) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022846   Gene: ENSLAFG00000002946   Transcript: ENSLAFT00000032417
Sequence length 321
Comment pep:novel supercontig:loxAfr3:scaffold_71:6049544:6060092:-1 gene:ENSLAFG00000002946 transcript:ENSLAFT00000032417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SWSRPPCPMSPEEKLDPLPDNFILQPPVFYPVIPYVTTIFGGLHTGKMVMLQGVVPQNAL
SRFQVDFQCGCSVQPRPDIAIHFNPRFHTTKPHVICNTLHGGRWQAEARWPGLALQRGAS
FLILFLFGNEAVKVSVNGHHFLHYPYRLPLSRVDTLGIFGDILVKAVGFLNINVSSLGAK
AWVAAVFNVLWHLDREVPCSRALPRGLWPGQVIIVRGLVLQESKDFTLSLRDRSAYVPVT
LRASFTDRTLAWISPWGRKKLILAPFLFYPQRFFEVLLLCHEGGLKLALNGQGLGATSLD
QRALERLRELRISGSIQLYCV
Download sequence
Identical sequences G3U9Y8
ENSLAFP00000024646 ENSLAFP00000022846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]