SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022876 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000022876
Domain Number 1 Region: 114-246
Classification Level Classification E-value
Superfamily C-type lectin-like 8.4e-35
Family C-type lectin domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022876   Gene: ENSLAFG00000015125   Transcript: ENSLAFT00000029304
Sequence length 247
Comment pep:novel supercontig:loxAfr3:scaffold_251:187166:200889:-1 gene:ENSLAFG00000015125 transcript:ENSLAFT00000029304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNQTVTYSELNLAKNPKRQQIKPTDSDRSISITEQEITYVELNFHGASQDLQKNDKNFH
CKVYLPSPPGKLVAGILGITCIALMASIIIIKIKVITPLNNASSMGTKSGKFILSFSKFC
NSYSFSASHCGHCPEDWLSYSNNCYYISSDKKNWTESQMACASKKSDLTYIDNEEEMKFI
AFLSSLSWIGLSRKNRDYSWLWINGSPLYKELIDTSNNTYNCAMLFSSNLLSDSCGSSKT
YICKHKI
Download sequence
Identical sequences G3U4W8
ENSLAFP00000022876 ENSLAFP00000022876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]