SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000023301 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000023301
Domain Number 1 Region: 19-131
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.96e-43
Family Pyk2-associated protein beta ARF-GAP domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000023301   Gene: ENSLAFG00000007948   Transcript: ENSLAFT00000026438
Sequence length 441
Comment pep:novel supercontig:loxAfr3:scaffold_0:95107980:95234902:-1 gene:ENSLAFG00000007948 transcript:ENSLAFT00000026438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIH
RNLGVHISRVKSVNLDQWTPEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIR
DKYEKKKYYDKNAIAITNKEKEKKKEEKKREKEPEKPAKPLTTEKLQKKEDQQLELKKST
SPKKTAEPTVDLLGLDGPAEAPVTNGNTTTMPALNDDLDIFGPMISNPLPTTVMPPAQGT
LTVPAAAPLSIAPGDLDLFTEQTTKAEESTKKQLSKDSILSLYGTGTIQQQNTPGMFMGP
ANIPFTSQAPPAFQGFPSMGVPVPAAPGLMGNVMGQSASMMVGMPMPNGFMGSAQTGVMP
LPQNVAGPQGGMVGQMGASQSKFGLPQTQQPQWSLSQMNQQMAGMSINSANPAVGFGQPP
STTAGWSGSSSGQTLSTQLWK
Download sequence
Identical sequences G3T0X2
ENSLAFP00000006664 ENSLAFP00000023301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]