SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000023349 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000023349
Domain Number 1 Region: 6-134
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.87e-43
Family Galectin (animal S-lectin) 0.000000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000023349   Gene: ENSLAFG00000028162   Transcript: ENSLAFT00000031545
Sequence length 135
Comment pep:novel supercontig:loxAfr3:scaffold_73:7892686:7894406:-1 gene:ENSLAFG00000028162 transcript:ENSLAFT00000031545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAQGLVANNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFDAHGDVNVIV
CNSKDGGAWGTEQRESVFPFQPGSVVEVCISFDQADLSIKLPDGYSFKFPNRLDLEAISY
MAADGDFKVKCVAFE
Download sequence
Identical sequences G3U691
ENSLAFP00000023349 ENSLAFP00000023349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]